PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN00223.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 246aa    MW: 28430.8 Da    PI: 6.7164
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN00223.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.71.3e-18552148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  l+++v+ +G g+W++ ar  g++Rt+k+c++rw++yl
       KHN00223.1  5 KGPWTEEEDSVLINYVNVHGEGHWNSLARSSGLKRTGKSCRLRWFNYL 52
                     79********************************************97 PP

2Myb_DNA-binding461.2e-1458101146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T +E++l+++++  +G++ W++Ia+ ++ gRt++++k++w++
       KHN00223.1  58 RGNITLQEQLLILELHSHWGNR-WAKIAEQLP-GRTDNEIKNYWRT 101
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.312156IPR017930Myb domain
SuperFamilySSF466891.76E-30399IPR009057Homeodomain-like
SMARTSM007175.2E-15454IPR001005SANT/Myb domain
PfamPF002497.6E-16552IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-22659IPR009057Homeodomain-like
CDDcd001675.02E-11752No hitNo description
SMARTSM007174.7E-1357105IPR001005SANT/Myb domain
PROSITE profilePS5129418.58557107IPR017930Myb domain
PfamPF002491.1E-1358101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-2160105IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MVIKKGPWTE EEDSVLINYV NVHGEGHWNS LARSSGLKRT GKSCRLRWFN YLRPNVRRGN  60
ITLQEQLLIL ELHSHWGNRW AKIAEQLPGR TDNEIKNYWR TRVVKQAKQL KCHVNSKQFR  120
DALRFVWMPR LMEQIQASSS SYGLDQTTLC NTQTHRDNSM VSSYSSEVDL QPPSLSDTSI  180
TSSSYNLIGD GGLSTESAEK GSIYSLWQHW DYSDIQAFEP CNGFGDADLW TDENMWFLQQ  240
HLADEL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-2451077108B-MYB
1h8a_C2e-2439925120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5892990.0KC589299.1 Macrotyloma uniflorum cultivar VZM-1 transcription factor MYB76 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001235761.10.0MYB transcription factor MYB76
SwissprotQ9LDE12e-66MY108_ARATH; Transcription factor MYB108
TrEMBLQ0PJK70.0Q0PJK7_SOYBN; MYB transcription factor MYB76
STRINGGLYMA02G01300.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87534125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47190.17e-67myb domain protein 2